ich kann mein guthaben nicht aufladen vodafone

"displaySubject" : "true", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "message" : "1979172", ] //$('#lia-body').addClass('lia-window-scroll'); Wählen Sie auf der Seite "Online aufladen" aus. { "event" : "addThreadUserEmailSubscription", "actions" : [ "event" : "addMessageUserEmailSubscription", var ctaHTML = '. } })(LITHIUM.jQuery); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "action" : "rerender" "action" : "rerender" LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; if (element.hasClass('active')) { { Im Anschluss kam die SMS dass ich nun ohne Internet Pack surfe. Mehr dazu: Wie übertrage ich Guthaben von Handy zu Handy? ] "action" : "rerender" { $(this).removeAttr('href'); Bei FONIC, Netzclub und Tschibo nutzen Sie de Zeichenfolge *101#. }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. LITHIUM.AjaxSupport.ComponentEvents.set({ { es erscheinen immerwieder probleme etc. "actions" : [ }, { "context" : "envParam:quiltName,message", "action" : "rerender" warum muß ich meine prepaid-karte aufladen trotz guthaben? Bezahlen könnt ihr dann durch Eingabe eines Nutzernamens und … { "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ if (event.target.matches('.redirect')) { "action" : "rerender" $('#custom-overall-notif-count').html(notifCount); "event" : "ProductMessageEdit", "event" : "ProductMessageEdit", "actions" : [ if ( count == neededkeys.length ) { "selector" : "#kudosButtonV2_1", } }, }, count++; ] { "event" : "ProductAnswer", notifCount = parseInt($(this).html()) + notifCount; "quiltName" : "ForumMessage", Sonst kann es Schwierigkeiten geben, das Geld zuzuordnen. "context" : "", } "context" : "", ], { "action" : "rerender" "context" : "", "action" : "rerender" "action" : "rerender" // Oops. .attr('aria-selected','false'); "actions" : [ Im Display wird Ihnen dann umgehend Ihr Kontostand angezeigt und wie lange dieses Guthaben noch verfügbar ist, bevor es verfällt. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", { "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_65b50b2b75783d","tooltipContentSelector":"#link_65b50b2b75783d_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_65b50b2b75783d_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); Du lädst einfach dein persönliches Kundenkonto mit Guthaben auf und löst es anschließend für deine persönlichen Zwecke ein. Die Nummer funktioniert nur aus dem Ausland. event.preventDefault(); "context" : "", ], }, "linkDisabled" : "false" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. { $(event.data.selector).addClass('cssmenu-open') "event" : "ProductAnswerComment", } Nun können Sie entscheiden, wie hoch der Aufladebetrag sein soll: Wählen Sie die 1, sind es 15€, bei 2 sind es 25€, bei 3 sind es 50€, die auf Ihr Konto gebucht werden und sofort zur Verfügung stehen. "actions" : [ { } } "actions" : [ "actions" : [ { "actions" : [ { ] } "displayStyle" : "horizontal", }, { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "accessibility" : false, { Ich habe genau wie darauf beschrieben und wie ich es immer gemacht die Aufladenummer (22922) angerufen. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. { }); LITHIUM.AjaxSupport.ComponentEvents.set({ }, // Set start to true only if the first key in the sequence is pressed "initiatorBinding" : true, var cookieDomain = 'forum.vodafone.de'; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "linkDisabled" : "false" }); "disableKudosForAnonUser" : "false", { $('#node-menu li.has-sub>a').on('click', function(){ Du kannst natürlich Deine CallYa-Karte auch über Dein Bankkonto aufladen. "event" : "addMessageUserEmailSubscription", }, "event" : "expandMessage", "eventActions" : [ "actions" : [ "context" : "", ] "event" : "removeThreadUserEmailSubscription", "displayStyle" : "horizontal", ] }); "parameters" : { "action" : "rerender" } "actions" : [ bei der Telekom, O2, Vodafone und E-Plus. (vodafone D2) ~*EmO_KiTTy*~ 21. "context" : "", $(document).ready(function(){ }, "context" : "", "useTruncatedSubject" : "true", "event" : "deleteMessage", "accessibility" : false, Sinkt das Guthaben also zu sehr und reicht nicht mehr aus um eine Verbindung aufzubauen, ist man von der mobilen Kommunikation abgeschnitten. }, { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "eventActions" : [ { Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { } { LITHIUM.AjaxSupport.ComponentEvents.set({ }, var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_65b50b2b75783d","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] }, "disallowZeroCount" : "false", "activecastFullscreen" : false, }); window.location.replace('/t5/user/userloginpage'); } $(document).ready(function(){ "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "parameters" : { Es gibt zwei Optionen, wie du Dein Vodafone Prepaid Guthaben aufladen kannst. "action" : "rerender" LITHIUM.Dialog({ ] LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditCommentForm", "message" : "1979178", Dein Vodafone Guthaben … /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234242}); Doch dank der Internet-Aufladung sollte es Ihnen auch gelingen, Ihr Vodafone-Guthaben von zu Hause oder unterwegs aus aufzuladen, wenn mal kein … }, Ich habe mir vor einigen Tagen bei Edeka eine Prepaidkarte von E-Plus für 15 Eure gekauft und wollte damit mein Handyguthaben aufladen. "selector" : "#messageview", }, .attr('aria-expanded','false'); Zum Aufladen Deines Vodafone Guthabens hast Du nachfolgende Möglichkeiten. }, "context" : "", element.addClass('active'); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); }, "event" : "AcceptSolutionAction", }, }, { Sie gelangen auf die Seite, auf der Sie die Höhe der Aufladung auswählen können. Um dein Guthaben ganz einfach automatisch per Bankeinzug aufladen zu können, musst du das SEPA-Lastschriftmandat bestätigen. }, { "action" : "rerender" } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234242}); // We made it! }, Der Code wird unmittelbar nach Zahlungseingang an die von Ihnen angegebene Email-Adresse gesendet. "actions" : [ Du hast die App noch nicht? "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "}); { Ich benutze seit Jahren Vodafone Prepaid auch CallYa genannt. // If watching, pay attention to key presses, looking for right sequence. LITHIUM.AjaxSupport.useTickets = false; ] "disableKudosForAnonUser" : "false", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] $(this).toggleClass("view-btn-open view-btn-close"); $(this).removeAttr('href'); } }(LITHIUM.jQuery)); ] { "context" : "", "disallowZeroCount" : "false", } { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "parameters" : { "event" : "removeMessageUserEmailSubscription", } Geben Sie *100*Aufladecode# in Ihr Handy ein und drücken Sie anschließend die Ruftaste bzw. } "action" : "rerender" "action" : "rerender" }, Der 13-stellige Zifferncode des Auflade-Bons wurde 3 Mal falsch eingegeben. } "context" : "envParam:quiltName,product,contextId,contextUrl", var clickHandler = function(event) { "event" : "AcceptSolutionAction", "actions" : [ "event" : "addThreadUserEmailSubscription", Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. .attr('aria-hidden','true') "context" : "envParam:quiltName,message", "event" : "unapproveMessage", ] }); "event" : "deleteMessage", "context" : "envParam:quiltName", }, } "actions" : [ "event" : "MessagesWidgetEditCommentForm", Weitere Infos findest Du auf unserer … { ] } "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "action" : "rerender" { "context" : "", "action" : "rerender" "}); "action" : "rerender" }, }); LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '7H1Lu1nvg_ofx4cW0yyqSep67tUg4YfpbefeXy5AUhw. }, "action" : "rerender" "displayStyle" : "horizontal", { "event" : "MessagesWidgetCommentForm", "actions" : [ Sie sind Vodafonekunde und wollen Ihre CallYa-Karte aufladen? { ] { //resetMenu(); "action" : "pulsate" { "event" : "unapproveMessage", "action" : "rerender" { "parameters" : { } }, resetMenu(); "context" : "", Das klingt erstmal gut, doch der Teufel steckt im Detail. "event" : "kudoEntity", ] "actions" : [ //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "context" : "envParam:feedbackData", element.children('ul').slideDown(); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "quiltName" : "ForumMessage", "action" : "pulsate" { { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" Ich habe einen Festnetzanschluss, der gewöhnlich genutzt wird. ], "actions" : [ $(document).ready(function(){ Mein Guthaben beträgt in etwa 19 Euro und so bekomme ich heute morgen eine sms, dass der Basispreis (10 Euro) nicht abgebucht werden kann und dass ich doch bitte meine Karte aufladen sollte. //var height = $(window).scrollTop(); { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "selector" : "#kudosButtonV2_1", ], return; "context" : "envParam:quiltName,expandedQuiltName", { "showCountOnly" : "false", ] Während der Öffnungszeiten von Geschäften, die CallNow-Karten führen, wie zum Beispiel Tankstellen, ist dies kein Problem. { } "context" : "", { "selector" : "#messageview_0", Betreff: Ich kann kein Guthaben aufladen ! //$('#lia-body').addClass('lia-window-scroll'); $(document).ready(function(){ "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "disableLinks" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ }, }, ] Selbstverständlich sollte Ihnen dies mit diesen Hinweisen keine Probleme bereiten. "action" : "rerender" // just for convenience, you need a login anyways... ;(function($) { "context" : "envParam:quiltName", ] "action" : "rerender" ich habe gelesen, dass lyca die über vodafone betrieben wird. "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "accessibility" : false, "event" : "RevokeSolutionAction", }); "action" : "pulsate" var clickedDomElement = $(this); }, { }); "action" : "rerender" //if(height > 430) { { { "action" : "rerender" Antworten. { "context" : "", }, "event" : "kudoEntity", Mit der Direktaufladung können Sie noch schneller und einfacher Vodafone aufladen, denn Sie sparen sich den Umweg über einem Aufladecode, denn das Guthaben wird direkt auf die angegebene Vodafone Rufnummer geladen. Hinterlassen Sie online bei Mein Otelo Ihre Kontodaten,können Sie unter der Rufnummer auch Ihr Konto mit einer Aufladung im gewünschten Betrag belasten. "event" : "MessagesWidgetCommentForm", "event" : "ProductAnswer", { $('div[class*="-menu-btn"]').removeClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { LITHIUM.AjaxSupport.ComponentEvents.set({ { }, { "eventActions" : [ { }); }, { Lädt man innerhalb der einmonatigen Frist seine Karte erneut mit einem Guthaben auf, so bleibt die Karte aktiviert und eine Kündigung findet nicht statt. { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ Folgendes kann verantwortlich sein: Wenn Sie Ihre B.free SIM vor dem 01.01.2019 aktiviert haben, ist vor einer Neuaufladung ab 01.09.2019 eine Registrierung notwendig. { var ctaHTML = ''; "parameters" : { // --> Per Tastenkombination: *100*(Aufladecode)# eintippen und anschließend die Wahltaste drücken. }); }); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { "action" : "rerender" "action" : "rerender" Die Zahlung des Guthabens erfolgt mit einer unserer sicheren Zahlungsmethoden, wie z. "messageViewOptions" : "1111110111111111111110111110100101001101" { { Ihre Vodafone Guthaben können Sie im Handumdrehen mit dem Code, den Sie von Guthaben.de erhalten haben, aufladen. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ctaHTML += "Lösung noch nicht gefunden? "action" : "rerender" } "buttonDialogCloseAlt" : "Schließen", Wenn ihr eine Prepaid-SIM-Karte von Vodafone habt und euer Guthaben zu Ende geht, könnt ihr es wieder aufladen. Schreib uns in die Kommentare / 1 Kommentar zu „Vodafone CallYa Guthaben abfragen – so geht’s“ Eva-Maria Meinecke. "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "entity" : "1979181", "context" : "", "disableLabelLinks" : "false", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979181,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "expandMessage", // Set start to true only if the first key in the sequence is pressed Deine E-Mail-Adresse wird nicht veröffentlicht. "event" : "MessagesWidgetEditAnswerForm", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorDataMatcher" : "data-lia-message-uid" .attr('aria-expanded','false') }, "initiatorDataMatcher" : "data-lia-kudos-id" "parameters" : { } "actions" : [ "useSimpleView" : "false", }, Der Mobilfunkanbieter otelo ist eine hundertprozentige Tochter von Vodafone. { "context" : "", { "entity" : "1979172", "actions" : [ { "useTruncatedSubject" : "true", Diese Hinweise helfen Ihnen, die geeignete Methode zu finden. } }, ] // Register the click event handler LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", LITHIUM.Dialog.options['-1828423795'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "deleteMessage", { }, } "action" : "rerender" "context" : "", Option 1: Öffne die Anruf-App auf deinem Smartphone, indem du auf das Telefonhörer-Symbol tippst. ] ] "actions" : [ "action" : "rerender" } else { ] }, { "event" : "MessagesWidgetCommentForm", "event" : "markAsSpamWithoutRedirect", { "context" : "envParam:selectedMessage", das handy wird sehr wenig benützt ich benötige aber diese rufnummer in unregelmässigen abständen und wurde auch an alle wichtigen personen weitergegeben. "action" : "pulsate" "action" : "rerender" "context" : "", "selector" : "#messageview_0",

Wetter Dortmund Morgen, Marienhospital Stuttgart Ausbildung, Oberbürgermeisterwahl Mönchengladbach 2020 Kandidaten, Home Office Psyche, Wann Verfallen Theoriestunden Fahrschule, Gebäude Afa Bei Rechtsnachfolger,

Dezember 29, 2020Permalink Kommentar hinzufügen

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.